PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g31750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ZF-HD
Protein Properties Length: 270aa    MW: 30695.4 Da    PI: 8.9309
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g31750genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1001.7e-3181136258
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  ++vrY+eC++NhAa+ Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
    Tp3g31750  81 RSVRYRECQRNHAANSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEID 136
                  579**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-3569145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-2983135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.4E-2984135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.41785134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.89E-17198267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28199268IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-29206263IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEVREKKDEK MEMARGRSSP NHQMLDHRLP PYTCPQTADK EKPTTRRNGS NPDPDLDTNP  60
ISTIAPAPRS YARPQTTSPT RSVRYRECQR NHAANSGGHV VDGCGEFMSS GEEGTAESLL  120
CAACDCHRSF HRKEIDGMFV VKFNSFGHSQ RPILGHHVSP IMMSFGDCGG GGGGGRDPAE  180
SSTEDLNKFH QSFSGNGVDQ LQYHPKKRFR TKFNQEQKEK MMEFAERIGW RMSKTEDEEV  240
NRFCREINVK RQVFKVWMHN NKQGAKKKEM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-202072621873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695813.11e-169PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-147ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR931e-169A0A078JR93_BRANA; BnaCnng66730D protein
STRINGBra037224.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-146homeobox protein 24